DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp8

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_038950249.1 Gene:Fkbp8 / 290652 RGDID:1308670 Length:410 Species:Rattus norvegicus


Alignment Length:214 Identity:55/214 - (25%)
Similarity:85/214 - (39%) Gaps:50/214 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 LENGEEEDD-DDVDEDNEESGEEDEQDSDDSEAEEEQPKAKVAKLSPGASAKKSGKEQNGVAKKE 212
            ||..|..|. ||.:|:::.||....:|......||.:        .|||.|::.      :|..|
  Rat    21 LEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAE--------QPGALAREF------LAATE 71

  Fly   213 EAKQQQKKKEKPEAKKEQPKAKEPAKQQPASKDPRTITGG-----VKIVDQVVGKGEEAKQGKRV 272
                                 .||| ..||.::...|.|.     ..:|....|.....| |:.|
  Rat    72 ---------------------PEPA-PAPAPEEWLDILGNGLLRKKTLVPGPTGSSRPLK-GQVV 113

  Fly   273 SVYYIGRLQSNNKTFDSLLKGKP-FKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARG 336
            :|:....|::..:     ::.:| ..|.||..:||:..|:.|..|.||...::|......||.:|
  Rat   114 TVHLQMSLENGTR-----VQEEPELAFTLGDCDVIQALDLSVPLMHVGETAMVTADSKYCYGPQG 173

  Fly   337 A-PPKIGPNSTLVFEVELK 354
            : .|.|.|::.|..||.||
  Rat   174 SRSPYIPPHAALCLEVTLK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 26/93 (28%)
Fkbp8XP_038950249.1 FKBP_C 103..192 CDD:395196 27/94 (29%)
TPR <206..336 CDD:223533
TPR repeat 270..298 CDD:276809
TPR repeat 303..333 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.