DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp9

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_036186.2 Gene:Fkbp9 / 27055 MGIID:1350921 Length:570 Species:Mus musculus


Alignment Length:88 Identity:29/88 - (32%)
Similarity:47/88 - (53%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 AKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHM 330
            :|:|..:..:|...|........:...||.:...||.|:|:.|.|:|:..|.||.||.:..|||:
Mouse   386 SKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGSGQVVLGMDMGLREMCVGEKRTVIIPPHL 450

  Fly   331 AYGARGAPPKIGPNSTLVFEVEL 353
            .||..|...::..::.|||::||
Mouse   451 GYGEAGVDGEVPGSAVLVFDIEL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 29/88 (33%)
Fkbp9NP_036186.2 FKBP_C 47..139 CDD:278674
FKBP_C 159..251 CDD:278674
FKBP_C 271..362 CDD:278674
FKBP_C 382..474 CDD:278674 29/88 (33%)
EF-hand_7 495..559 CDD:290234
EFh 497..558 CDD:238008
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 567..570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.