DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp4

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001178792.1 Gene:Fkbp4 / 260321 RGDID:628729 Length:458 Species:Rattus norvegicus


Alignment Length:132 Identity:61/132 - (46%)
Similarity:75/132 - (56%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 KEQPKAKEPAKQQPASKD-----PRTITGGVKIVDQVVGKGEEAKQGKRVSVYYIGRLQSNNKTF 287
            :|...|:..|:..|...:     |:...|.:|::.:.....|.|..|.||.|:|.|.|....| |
  Rat     4 EEMKVAENGAQSAPLPLEGVDISPKQDEGVLKVIKREGTGTETAMIGDRVFVHYTGWLLDGTK-F 67

  Fly   288 DSLLKGK-PFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEV 351
            ||.|..| .|.|.||.|||||.||:.||.||||....|||.|..|||:.|:||||.||:||||||
  Rat    68 DSSLDRKDKFSFDLGKGEVIKAWDIAVATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEV 132

  Fly   352 EL 353
            ||
  Rat   133 EL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 54/93 (58%)
Fkbp4NP_001178792.1 FKBP_C 43..134 CDD:278674 52/91 (57%)
Interaction with tubulin 267..400
TPR_11 274..349 CDD:290150
TPR repeat 274..301 CDD:276809
TPR repeat 306..348 CDD:276809
TPR_1 321..352 CDD:278916
TPR_11 322..384 CDD:290150
TPR repeat 353..381 CDD:276809
TPR_2 354..386 CDD:285020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.