DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and SPAC27F1.06c

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_594535.1 Gene:SPAC27F1.06c / 2541479 PomBaseID:SPAC27F1.06c Length:362 Species:Schizosaccharomyces pombe


Alignment Length:336 Identity:122/336 - (36%)
Similarity:175/336 - (52%) Gaps:46/336 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DKGQEAKLYLAAEKQEYIVATVTK-AIPQVALDLNFSKGDRIMF-YTAGDASVSLLG--YLHDID 91
            :.|:|:...|..| :::.:.|:.| ::.|..:|:.||.|:.:.| ...||..|.|.|  .:.:|.
pombe    64 EDGEESDEELFQE-EKFTLCTLKKGSVYQQPIDIIFSPGEEVFFERVGGDIPVYLSGTCIITNIP 127

  Fly    92 SEDDEDDDQMTIENLLNSKAIKNSKKSEDDEDENESGEEDEEDTDDDSQIIEEYESFLENGEEED 156
            .|:|..|    :||.....|           ||..|   |||:.||.|....|.|      |||:
pombe   128 EEEDSSD----LENDFLYGA-----------DEFSS---DEEEMDDISVTSSEEE------EEEN 168

  Fly   157 DDDVDEDNEESGEEDEQDSDDSEAEEEQPKAKVAKLSPGASAKKSGKEQNGVAKKEEAKQQQKKK 221
            ...::|.|  |.|||.:.:::...|:..||.:||:.......||..||:.......::...:|:|
pombe   169 GARIEELN--SDEEDAEQAEEEILEKPVPKDEVAEKHSKDKLKKEEKEKKTAVDVSDSVNGKKRK 231

  Fly   222 EKPEAKKEQPKAKEPAKQQPASKDPRT-----ITGGVKIVDQVVGKGEEAKQGKRVSVYYIGRLQ 281
            .:|..:.||.:.|        ||..:|     :.|.|.:.|:|.|.|..||:.||||:.||||| 
pombe   232 TEPAGEGEQTEKK--------SKSTKTYPKQVLEGNVTVQDKVKGDGPAAKRKKRVSMRYIGRL- 287

  Fly   282 SNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNST 346
            :|.|.||..:.||||.|.||..|||||||||:.||:|||:|.|..|..||||::.. |.|..||.
pombe   288 TNGKVFDKNITGKPFTFNLGLEEVIKGWDVGIVGMQVGGERTIHIPAAMAYGSKRL-PGIPANSD 351

  Fly   347 LVFEVELKAVH 357
            |||:|:|.||:
pombe   352 LVFDVKLLAVN 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 52/91 (57%)
SPAC27F1.06cNP_594535.1 FkpA 152..362 CDD:223619 91/227 (40%)
FKBP_C 272..359 CDD:278674 51/88 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I1783
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 154 1.000 Inparanoid score I1285
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46988
orthoMCL 1 0.900 - - OOG6_104296
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5708
TreeFam 1 0.960 - -
87.720

Return to query results.
Submit another query.