DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and FKBP8

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_036313.3 Gene:FKBP8 / 23770 HGNCID:3724 Length:413 Species:Homo sapiens


Alignment Length:207 Identity:56/207 - (27%)
Similarity:91/207 - (43%) Gaps:33/207 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 EDDDDVDEDNEESGEEDEQDSDDSEAEEEQPKAKVAKLSPGASAKKSGKEQNGVAKKEEAKQQQK 219
            ||.:.:|...:..|||:|:       |||:.:..:::|.|        .|..|....|||     
Human    22 EDFEVLDGVEDAEGEEEEE-------EEEEEEDDLSELPP--------LEDMGQPPAEEA----- 66

  Fly   220 KKEKPEA-KKEQPKAKEP-AKQQPASKDPRTITGGVKIVDQVVGKGEEAK----QGKRVSVYYIG 278
              |:|.| .:|...|.|| ....||.::...|.|...:..:.:..|....    :|:.|:|:   
Human    67 --EQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVH--- 126

  Fly   279 RLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGA-PPKIG 342
             ||::.:....:.:.....|.||..:||:..|:.|..|.||...::|......||.:|: .|.|.
Human   127 -LQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIP 190

  Fly   343 PNSTLVFEVELK 354
            |::.|..||.||
Human   191 PHAALCLEVTLK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 26/96 (27%)
FKBP8NP_036313.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..68 17/67 (25%)
FKBP_C 113..202 CDD:278674 25/92 (27%)
TPR_11 222..304 CDD:290150
TPR 1 222..255
TPR repeat 231..267 CDD:276809
TPR repeat 272..302 CDD:276809
TPR 2 273..306
TPR_11 274..338 CDD:290150
TPR 3 307..340
TPR 307..340 CDD:197478
TPR repeat 307..335 CDD:276809
TPR repeat 341..369 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149455
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.