Sequence 1: | NP_524364.2 | Gene: | Fkbp39 / 41860 | FlyBaseID: | FBgn0013269 | Length: | 357 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036313.3 | Gene: | FKBP8 / 23770 | HGNCID: | 3724 | Length: | 413 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 56/207 - (27%) |
---|---|---|---|
Similarity: | 91/207 - (43%) | Gaps: | 33/207 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 155 EDDDDVDEDNEESGEEDEQDSDDSEAEEEQPKAKVAKLSPGASAKKSGKEQNGVAKKEEAKQQQK 219
Fly 220 KKEKPEA-KKEQPKAKEP-AKQQPASKDPRTITGGVKIVDQVVGKGEEAK----QGKRVSVYYIG 278
Fly 279 RLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGA-PPKIG 342
Fly 343 PNSTLVFEVELK 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fkbp39 | NP_524364.2 | FKBP_C | 262..354 | CDD:278674 | 26/96 (27%) |
FKBP8 | NP_036313.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..68 | 17/67 (25%) | |
FKBP_C | 113..202 | CDD:278674 | 25/92 (27%) | ||
TPR_11 | 222..304 | CDD:290150 | |||
TPR 1 | 222..255 | ||||
TPR repeat | 231..267 | CDD:276809 | |||
TPR repeat | 272..302 | CDD:276809 | |||
TPR 2 | 273..306 | ||||
TPR_11 | 274..338 | CDD:290150 | |||
TPR 3 | 307..340 | ||||
TPR | 307..340 | CDD:197478 | |||
TPR repeat | 307..335 | CDD:276809 | |||
TPR repeat | 341..369 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165149455 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |