DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and FKBP5

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_004108.1 Gene:FKBP5 / 2289 HGNCID:3721 Length:457 Species:Homo sapiens


Alignment Length:136 Identity:61/136 - (44%)
Similarity:80/136 - (58%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 EKPEAKKEQPKA--KEPAKQQPASKDPRTITGGVKIVDQVVGKGEEAKQ-GKRVSVYYIGRLQSN 283
            |..:..:|.|.|  .|..:...:.||    .|.:|||.: ||.|||... |.:|.|:|.|:| ||
Human     5 EGAKNNEESPTATVAEQGEDITSKKD----RGVLKIVKR-VGNGEETPMIGDKVYVHYKGKL-SN 63

  Fly   284 NKTFDSLL-KGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTL 347
            .|.|||.. :.:||.|:||.|:|||.||:|||.||.|....:.|.|..|||:.|:.|||..|:||
Human    64 GKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATL 128

  Fly   348 VFEVEL 353
            .||:||
Human   129 FFEIEL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 53/103 (51%)
FKBP5NP_004108.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 5/18 (28%)
FKBP_C 43..135 CDD:459735 48/93 (52%)
TPR 266..>403 CDD:440225
TPR 1 268..301
TPR repeat 268..296 CDD:276809
TPR 2 317..350
TPR repeat 319..345 CDD:276809
TPR repeat 350..380 CDD:276809
TPR 3 351..384
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..457
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.