DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and FKBP4

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_002005.1 Gene:FKBP4 / 2288 HGNCID:3720 Length:459 Species:Homo sapiens


Alignment Length:133 Identity:62/133 - (46%)
Similarity:75/133 - (56%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 EQPKAKE------PAKQQPASKDPRTITGGVKIVDQVVGKGEEAKQ-GKRVSVYYIGRLQSNNKT 286
            |:.||.|      |...:.....|:...|.:|::.: .|.|.|... |.||.|:|.|.|....| 
Human     4 EEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKR-EGTGTEMPMIGDRVFVHYTGWLLDGTK- 66

  Fly   287 FDSLLKGK-PFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFE 350
            |||.|..| .|.|.||.|||||.||:.:|.||||....|||.|..|||:.|:||||.||:|||||
Human    67 FDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFE 131

  Fly   351 VEL 353
            |||
Human   132 VEL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 55/103 (53%)
FKBP4NP_002005.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 5/19 (26%)
FKBP_C 43..134 CDD:459735 51/91 (56%)
FKBP_N_2 144..253 CDD:375495
Interaction with tubulin. /evidence=ECO:0000250 267..400
TPR repeat 274..301 CDD:276809
NlpI <275..429 CDD:443815
TPR repeat 306..348 CDD:276809
TPR repeat 353..381 CDD:276809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..459
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.