DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fkbp39 and FKBP4

DIOPT Version :9

Sequence 1:	NP_524364.2	Gene:	Fkbp39 / 41860	FlyBaseID:	FBgn0013269	Length:	357	Species:	Drosophila melanogaster
Sequence 2:	NP_002005.1	Gene:	FKBP4 / 2288	HGNCID:	3720	Length:	459	Species:	Homo sapiens

Alignment Length:	133	Identity:	62/133 - (46%)
Similarity:	75/133 - (56%)	Gaps:	10/133 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   229 EQPKAKE------PAKQQPASKDPRTITGGVKIVDQVVGKGEEAKQ-GKRVSVYYIGRLQSNNKT 286
            |:.||.|      |...:.....|:...|.:|::.: .|.|.|... |.||.|:|.|.|....|
Human     4 EEMKATESGAQSAPLPMEGVDISPKQDEGVLKVIKR-EGTGTEMPMIGDRVFVHYTGWLLDGTK- 66

  Fly   287 FDSLLKGK-PFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFE 350
            |||.|..| .|.|.||.|||||.||:.:|.||||....|||.|..|||:.|:||||.||:|||||
Human    67 FDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFE 131

  Fly   351 VEL 353
            |||
Human   132 VEL 134

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fkbp39	NP_524364.2	FKBP_C	262..354	CDD:278674	53/94 (56%)
FKBP4	NP_002005.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..24		5/19 (26%)
		FKBP_C	43..134	CDD:306713	51/91 (56%)
		FKBP_N	<155..254	CDD:332399
		TPR_11	<250..>395	CDD:330823
		Interaction with tubulin. /evidence=ECO:0000250	267..400
		TPR repeat	274..301	CDD:276809
		TPR repeat	306..348	CDD:276809
		TPR repeat	353..381	CDD:276809
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	421..459
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0545
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810