DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and FKBP2

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001357294.1 Gene:FKBP2 / 2286 HGNCID:3718 Length:171 Species:Homo sapiens


Alignment Length:89 Identity:42/89 - (47%)
Similarity:60/89 - (67%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 EAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPH 329
            ::::|..:.::|.|:|:...:...||.:.:||.|:||.|:||||||.|:.||..|.||.:..|..
Human    74 KSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSE 138

  Fly   330 MAYGARGAPPKIGPNSTLVFEVEL 353
            :.||.|||||||...:||||||||
Human   139 LGYGERGAPPKIPGGATLVFEVEL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 42/89 (47%)
FKBP2NP_001357294.1 FKBP_C 71..163 CDD:459735 42/89 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.