DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and FKBP1A

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_000792.1 Gene:FKBP1A / 2280 HGNCID:3711 Length:108 Species:Homo sapiens


Alignment Length:103 Identity:47/103 - (45%)
Similarity:61/103 - (59%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 GVKIVDQVVGKGEE-AKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAG 315
            ||::.....|.|.. .|:|:...|:|.|.|:...|...|..:.|||||.||..|||:||:.|||.
Human     2 GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQ 66

  Fly   316 MKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            |.||.:..:|..|..||||.|.|..|.|::||||:|||
Human    67 MSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVEL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 46/102 (45%)
FKBP1ANP_000792.1 FkpA 3..106 CDD:440311 46/102 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.