DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkb-6

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_508026.1 Gene:fkb-6 / 180371 WormBaseID:WBGene00001431 Length:431 Species:Caenorhabditis elegans


Alignment Length:104 Identity:45/104 - (43%)
Similarity:58/104 - (55%) Gaps:1/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 GGVKIVDQVVGKG-EEAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVA 314
            |||..:.:..|:| .:...|..|.|:|:|.|::..|...|..:|..|.|.||.|.||||||:|||
 Worm    14 GGVLKLIKKEGQGVVKPTTGTTVKVHYVGTLENGTKFDSSRDRGDQFSFNLGRGNVIKGWDLGVA 78

  Fly   315 GMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            .|..|.....|......||..|:||||...:||:|||||
 Worm    79 TMTKGEVAEFTIRSDYGYGDAGSPPKIPGGATLIFEVEL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 41/93 (44%)
fkb-6NP_508026.1 FKBP_C 26..117 CDD:278674 39/90 (43%)
TPR_11 254..334 CDD:290150
TPR repeat 254..282 CDD:276809
TPR repeat 291..332 CDD:276809
TPR_11 305..368 CDD:290150
TPR_1 337..370 CDD:278916
TPR repeat 337..365 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.