DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkb-5

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001367683.1 Gene:fkb-5 / 171974 WormBaseID:WBGene00001430 Length:300 Species:Caenorhabditis elegans


Alignment Length:277 Identity:59/277 - (21%)
Similarity:102/277 - (36%) Gaps:63/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 EDDDQMTIENLLNSKAIKNSKKSEDDEDENESGEEDEEDTDDDSQIIEEYESFLENGEEEDDDDV 160
            :|:|.:.|:.:...||.|...||:|.:                  :::::...           .
 Worm    61 KDEDGLEIKIIRPIKAEKCPIKSQDGD------------------VLDQWYKL-----------S 96

  Fly   161 DEDNEESGEEDEQDSDDSEAEEEQPKAKVAKLSPGASAKKSGKEQNGVAKKEEAKQ--------Q 217
            |:|.:|.|....:            |.....|..|.......:...|:.|.|:.|.        .
 Worm    97 DKDGKEIGSNFNK------------KPYTFTLGKGQVIPGMERAMTGMCKGEKRKVVIPGNLGFG 149

  Fly   218 QKKKEKPEAKKEQP-----KAKEPAKQQPASKDPRTITGGVKI-----VDQVVGKGEEAKQGKRV 272
            .|.:|:...|::|.     :..:..:..|..|  .|...|:.|     :|:  .|.:::|.|..:
 Worm   150 DKGRERDNIKEDQTLYYTVQLVDLFRAVPGEK--WTTDEGIVIEQTHKIDE--DKCKKSKSGDTI 210

  Fly   273 SVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGA 337
            ...|:..|:.......|..:..||.|.|...|||||.|:.:.||..|.:|.:..|....||..|.
 Worm   211 HQQYVLHLEDGTFVDSSFSRNAPFIFKLNNNEVIKGMDIAMTGMCEGERRQVVIPSDFGYGDDGR 275

  Fly   338 PPKIGPNSTLVFEVELK 354
            .|.|...:.|.|::.|:
 Worm   276 APAIPGKARLYFDITLE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 28/91 (31%)
fkb-5NP_001367683.1 FKBP_C 79..171 CDD:395196 18/132 (14%)
FKBP_C 202..291 CDD:395196 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.