DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp10

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_034351.2 Gene:Fkbp10 / 14230 MGIID:104769 Length:581 Species:Mus musculus


Alignment Length:86 Identity:34/86 - (39%)
Similarity:45/86 - (52%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 VSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARG 336
            |..:|.|.|.......:|..:|..:...:|.|.:|||.|.|:.||..|.||.|..||.:|||.:|
Mouse   176 VRYHYNGTLLDGTAFDNSYSRGGTYDTYIGSGWLIKGMDQGLLGMCPGEKRKIIIPPFLAYGEKG 240

  Fly   337 APPKIGPNSTLVFEVELKAVH 357
            ....|.|.::|||.|.|..||
Mouse   241 YGTVIPPQASLVFYVLLLDVH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 31/81 (38%)
Fkbp10NP_034351.2 FKBP_C 54..146 CDD:278674
FKBP_C 166..258 CDD:278674 31/81 (38%)
FKBP_C 278..370 CDD:278674
FKBP_C 391..482 CDD:278674
EF-hand_7 504..567 CDD:290234
EFh 505..566 CDD:238008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..581
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 578..581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839513
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.