DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp1a

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001289007.1 Gene:Fkbp1a / 14225 MGIID:95541 Length:150 Species:Mus musculus


Alignment Length:76 Identity:37/76 - (48%)
Similarity:46/76 - (60%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 GRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIG 342
            |.|:...|...|..:.|||||.||..|||:||:.|||.|.||.:..:......||||.|.|..|.
Mouse    71 GMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIP 135

  Fly   343 PNSTLVFEVEL 353
            |::||||:|||
Mouse   136 PHATLVFDVEL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 37/76 (49%)
Fkbp1aNP_001289007.1 FKBP_C 71..147 CDD:459735 37/76 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.