DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp4

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_012810222.1 Gene:fkbp4 / 100379681 XenbaseID:XB-GENE-948088 Length:450 Species:Xenopus tropicalis


Alignment Length:110 Identity:54/110 - (49%)
Similarity:66/110 - (60%) Gaps:4/110 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PRTITGGVKIVDQVVGKGEEAKQ-GKRVSVYYIGRLQSNNKTFDSLLKGK-PFKFALGGGEVIKG 308
            |:...|.:|::.: .|.||.... |.:|||:|.|.| ::...|||....| .|.|.||.|||||.
 Frog    23 PKGDQGVLKLIKK-EGTGENTPMIGDKVSVHYTGWL-TDGTQFDSSRDRKDKFTFDLGKGEVIKA 85

  Fly   309 WDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            ||:.||.||||....|.|.|..|||..|:||||.||:.|||||||
 Frog    86 WDIAVATMKVGEICQIVCKPEYAYGTSGSPPKIPPNAVLVFEVEL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 50/94 (53%)
fkbp4XP_012810222.1 FKBP_C 39..130 CDD:365980 48/91 (53%)
FKBP_C 156..246 CDD:365980
TPR <237..380 CDD:223533
TPR repeat 270..294 CDD:276809
TPR repeat 307..344 CDD:276809
TPR repeat 349..377 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.