DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbpl

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_001923918.1 Gene:fkbpl / 100149636 ZFINID:ZDB-GENE-030131-4744 Length:361 Species:Danio rerio


Alignment Length:234 Identity:51/234 - (21%)
Similarity:91/234 - (38%) Gaps:61/234 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SQTIIKSFHISGVALDKGQEAKLYLAAEKQEYIVATVTKAIPQVALDLNFSKGDRIMFYTAGDA- 79
            |||  ..|.:...:|..|||:....|.||..::::...:.      .|.|.|||   .:.|.|. 
Zfish   153 SQT--DCFTLELHSLTPGQESWQMTAEEKWAWVLSHKQRG------GLRFGKGD---IWGAADCY 206

  Fly    80 --SVSLLGYLHDIDSEDDEDDDQMTIENLLNSKAIKNS-KKSEDDEDENESGEEDEEDTDDDSQI 141
              :|.|                .:|::.....|.:..: |:.|::|||:|..:|..|..:|.:..
Zfish   207 CRAVKL----------------AITLQVQTRGKLVDETLKEDEENEDEDEDEDEGAESPNDSTIP 255

  Fly   142 IEEYESFLENGEEEDDDDVDEDNEESGEEDEQDSDDSEAEEEQPKA------------------- 187
            .|||::.    :.|...::.....:.|:..:......:|.|..||:                   
Zfish   256 NEEYKTV----KAELHCNLSLCQLKLGQLGKSKDSSIKATELNPKSTKAWYRHGQACLQLGELEE 316

  Fly   188 ------KVAKLSP-GASAKKSGKEQNGVAKKEEAKQQQK 219
                  |:.:|.| .|||:.:.|:.|...|..::|..|:
Zfish   317 SRMAFGKILELQPDSASARTALKQVNSKLKDLDSKLGQR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674
fkbplXP_001923918.1 TPR_11 263..329 CDD:290150 8/65 (12%)
TPR repeat 264..292 CDD:276809 3/27 (11%)
TPR repeat 297..327 CDD:276809 1/29 (3%)
TPR_8 299..330 CDD:289924 2/30 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.