DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp2

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001107353.1 Gene:fkbp2 / 100135178 XenbaseID:XB-GENE-958376 Length:141 Species:Xenopus tropicalis


Alignment Length:113 Identity:46/113 - (40%)
Similarity:69/113 - (61%) Gaps:4/113 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 ASKDPRTITGGV-KIVDQVVGKGEEAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEV 305
            ||:..:.:..|| |.|:..:.|   :::|..:.::|.|:|:...:...|:.:.:.|.|.||.|:|
 Frog    23 ASEGRKKLQIGVKKRVENCLVK---SRKGDTLHMHYTGKLEDGTEFDSSIPRNQAFTFTLGTGQV 84

  Fly   306 IKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            |||||.|:.||..|.||.:..|..:.||.|||||||...:||:|||||
 Frog    85 IKGWDQGLLGMCEGEKRKLVIPSELGYGDRGAPPKIPGGATLIFEVEL 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 40/92 (43%)
fkbp2NP_001107353.1 FKBP_C 41..133 CDD:365980 40/95 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.