DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp9

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001123385.1 Gene:fkbp9 / 100125793 XenbaseID:XB-GENE-1019523 Length:585 Species:Xenopus tropicalis


Alignment Length:88 Identity:29/88 - (32%)
Similarity:47/88 - (53%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 AKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHM 330
            :|:|..:..:|...|........:...||.:...||.|:|:.|.|:|:..|.:|.||.|..|||:
 Frog   399 SKKGDYLKYHYNATLMDGTVLDSTHQYGKTYNIVLGSGQVVMGMDIGLQDMCIGEKRNIVIPPHL 463

  Fly   331 AYGARGAPPKIGPNSTLVFEVEL 353
            .||..|...::..::.|||::||
 Frog   464 GYGEAGVEGEVPGSAVLVFDIEL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 29/88 (33%)
fkbp9NP_001123385.1 FKBP_C 60..152 CDD:365980
FKBP_C 172..264 CDD:365980
FKBP_C 284..375 CDD:365980
FKBP_C 395..487 CDD:365980 29/88 (33%)
EFh 510..571 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.