DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL9 and AT5G53070

DIOPT Version :9

Sequence 1:NP_524363.3 Gene:mRpL9 / 41859 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_200119.1 Gene:AT5G53070 / 835387 AraportID:AT5G53070 Length:221 Species:Arabidopsis thaliana


Alignment Length:146 Identity:34/146 - (23%)
Similarity:56/146 - (38%) Gaps:18/146 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 IEVVLKTFVEGVGDKGDVVSMKPHFVYNKLLLPGLAAYNTPENVAKYAKTEAEKSTVKHSSPYAQ 132
            :||:|.|.:|.:|..|:.|.:.|.:..|. |:|.|.|.   .|:.|||....|:..:.:.....:
plant    44 LEVILTTGIEKLGKAGETVKVAPGYFRNH-LMPKLLAV---PNIDKYAYLIREQRKMYNHEEVKE 104

  Fly   133 RTVNMLETIVLAVVMNKDEPWVLEPWHIKASLRKTGFYCREECITLPKERIEGPDLKKENKDFYC 197
            .         :.||....|....|.......|.......|:   .:.||:.:....|.:..|...
plant   105 E---------VKVVHKTSEVQTKEYEKAAKRLANANLVLRK---LVDKEKFKNRSSKDDKPDVQT 157

  Fly   198 TVTINKL--EQARLKC 211
            .:|..::  |.||..|
plant   158 PITKEEIVSEVARQLC 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 15/44 (34%)
AT5G53070NP_200119.1 rplI 45..198 CDD:234659 34/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0359
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21368
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.