DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL9 and MRPL9

DIOPT Version :9

Sequence 1:NP_524363.3 Gene:mRpL9 / 41859 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_113608.1 Gene:MRPL9 / 65005 HGNCID:14277 Length:267 Species:Homo sapiens


Alignment Length:234 Identity:67/234 - (28%)
Similarity:114/234 - (48%) Gaps:19/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SLQQQVRTTFVLKRKYDPPLHKTNEKPRRMRAKNFIYELVDDTLVKKRPNIEVVLKTFVEGVGDK 82
            ||.|. |.|.:::|.:..||.....|| |:..::.:|:||:||..:.:.|:|::|...||.||.:
Human    46 SLSQN-RGTVIVERWWKVPLAGEGRKP-RLHRRHRVYKLVEDTKHRPKENLELILTQSVENVGVR 108

  Fly    83 GDVVSMKPHFVYNKLLLPGLAAYNTPENVAKYAKTE---AEKSTVKHSSPYAQRTVNMLETIVLA 144
            ||:||:|.....|:||..|||.|.:|||...:.:.:   .|....|..:...:.||..|::..|.
Human   109 GDLVSVKKSLGRNRLLPQGLAVYASPENKKLFEEEKLLRQEGKLEKIQTKAGEATVKFLKSCRLE 173

  Fly   145 VVMNKDEPWVLEPWHI-KASLRKTGFYCREECITLPKERIE--GPDLKKENKDFYCTVTINKLEQ 206
            |.|..:..|.|.|..: :...:..|.......:.||:|.|.  |        :::|.||:|.|:.
Human   174 VGMKNNVKWELNPEIVARHFFKNLGVVVAPHTLKLPEEPITRWG--------EYWCEVTVNGLDT 230

  Fly   207 ARLKCRLHHWSTDPSERLPYVLEHWKLQSEPLLDVCSPE 245
            .|:...:.::....::|..|.|..   |:...:...||:
Human   231 VRVPMSVVNFEKPKTKRYKYWLAQ---QAAKAMAPTSPQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 21/44 (48%)
MRPL9NP_113608.1 rplI 95..225 CDD:234659 40/137 (29%)
Ribosomal_L9_N 95..140 CDD:396030 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144598
Domainoid 1 1.000 42 1.000 Domainoid score I12491
eggNOG 1 0.900 - - E1_COG0359
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12696
Inparanoid 1 1.050 85 1.000 Inparanoid score I5168
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46719
OrthoDB 1 1.010 - - D1036760at2759
OrthoFinder 1 1.000 - - FOG0005447
OrthoInspector 1 1.000 - - oto90975
orthoMCL 1 0.900 - - OOG6_110160
Panther 1 1.100 - - LDO PTHR21368
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4174
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.