DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL9 and mrpl-9

DIOPT Version :9

Sequence 1:NP_524363.3 Gene:mRpL9 / 41859 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_492810.2 Gene:mrpl-9 / 181833 WormBaseID:WBGene00015025 Length:276 Species:Caenorhabditis elegans


Alignment Length:212 Identity:63/212 - (29%)
Similarity:102/212 - (48%) Gaps:8/212 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QQQVRTTFVLKRKYDP---PLHKTNEKPRRMRAKNFIYELVDDTLVKKRPNIEVVLKTFVEGVGD 81
            :|..|.|:||:|.:.|   |.....:.|....... .||:|:....|....|.|:|...|||:|.
 Worm    16 RQASRNTWVLRRVFQPEVTPPGGVQKNPNDFHDYQ-KYEVVEFETQKSAGPINVILLQDVEGIGH 79

  Fly    82 KGDVVSMKPHFVYNKLLLPGLAAYNTPENVAKYA--KTE-AEKSTVKHSSPYAQRTVNM-LETIV 142
            :.||||:........|||...|.|.:|.::..|:  ||. ||:...:...||..:.|.. |:.:|
 Worm    80 QFDVVSVDRTLARKDLLLSKKAVYASPFDLKYYSDMKTRMAEELASRIRIPYELKVVGRDLQKMV 144

  Fly   143 LAVVMNKDEPWVLEPWHIKASLRKTGFYCREECITLPKERIEGPDLKKENKDFYCTVTINKLEQA 207
            :.:.:|.:..|.::...:|:|||:.|.:..|..|.|..:.|.||:...|.|.|...|.:|:....
 Worm   145 IPIKVNMENQWTIDRNLVKSSLRQMGVFVAENTIFLAAKPISGPNFDIEAKLFRFYVVVNQQYIV 209

  Fly   208 RLKCRLHHWSTDPSERL 224
            .:..|:.|.|.|.|:::
 Worm   210 PMLGRITHISVDESKQM 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 69..114 CDD:279605 16/44 (36%)
mrpl-9NP_492810.2 Ribosomal_L9_N 68..112 CDD:376513 16/43 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158334
Domainoid 1 1.000 47 0.342 Domainoid score I8085
eggNOG 1 0.900 - - E1_COG0359
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I3840
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46719
OrthoDB 1 1.010 - - D1036760at2759
OrthoFinder 1 1.000 - - FOG0005447
OrthoInspector 1 1.000 - - oto18165
orthoMCL 1 0.900 - - OOG6_110160
Panther 1 1.100 - - LDO PTHR21368
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4174
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.