DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL9 and mrpl9

DIOPT Version :10

Sequence 1:NP_524363.3 Gene:mRpL9 / 41859 FlyBaseID:FBgn0038319 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_031747718.1 Gene:mrpl9 / 116406867 XenbaseID:XB-GENE-17346938 Length:222 Species:Xenopus tropicalis


Alignment Length:67 Identity:18/67 - (26%)
Similarity:24/67 - (35%) Gaps:20/67 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SYYPTAMDSSSLN-------ISSTTGSPNSSHF-------------TTFTHFSTPSTSPSTSTQS 99
            |.:.|...||.:|       :::..|||.|...             ...|.||.||.|.|.|.:.
 Frog   405 SPFGTPFGSSVMNRMAGIFDVNTCYGSPQSPQLIRRGPRLWTSASDQQMTEFSNPSPSTSISAEG 469

  Fly   100 ST 101
            .|
 Frog   470 KT 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL9NP_524363.3 Ribosomal_L9_N 68..114 CDD:460146 13/47 (28%)
mrpl9XP_031747718.1 Ribosomal_L9_N 47..93 CDD:460146
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.