DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and gzma

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:285 Identity:76/285 - (26%)
Similarity:116/285 - (40%) Gaps:71/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 CGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDW 184
            |.::   .|.||...| ....||..|     |..:.|.|||.||...:|:||:||..........
Zfish    23 CSDV---SIVGGKDVK-KALSWMVSI-----QVNQNHKCGGILIHKEWVLTAAHCKEDSYSSVTV 78

  Fly   185 RLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQ 249
            .:..:.|.              :|.:..|..:.::|....         .|.:.:||.|:||:::
Zfish    79 LIGSLSLS--------------KGSQRIAIHNYEIPETFN---------KKTKKDDIMLIRLSKK 120

  Fly   250 VEYTDFVRPICLP---LDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDE----- 306
            |:    .:|..:|   .||.      .|....|.|||.|:      .|.|.|.:..:|.|     
Zfish   121 VK----AKPYKIPKKEKDVQ------PGTKCVVRGWGTTD------YKGKQASDKLQMLEVLVVD 169

  Fly   307 ---CQNVYSSQDILLEDTQMCAGG-KEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPC 367
               |...|:...::.:| .:|||. ::...:|.||||||| ..:.|       |.||:| |...|
Zfish   170 RVQCNRYYNRNPVITKD-MLCAGNTQQHRGTCLGDSGGPL-ECEKN-------LVGVLS-GSHGC 224

  Fly   368 GLAGWPGVYTLVGK-YVDWIQNTIE 391
            |....|.||||:.| ::.||...::
Zfish   225 GDPKKPTVYTLLSKRHITWINKILK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 73/271 (27%)
Tryp_SPc 128..389 CDD:238113 75/273 (27%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 75/273 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.