DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and gzmk

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017208551.1 Gene:gzmk / 794999 ZFINID:ZDB-GENE-091204-352 Length:267 Species:Danio rerio


Alignment Length:288 Identity:82/288 - (28%)
Similarity:127/288 - (44%) Gaps:70/288 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LPLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGK 178
            ||:   |.::   .|.||...| ....||..|     |.:|.|.|||.||..::|:|::.|   |
Zfish    30 LPV---CSDV---SIVGGKDVK-KALSWMVSI-----QKEKIHICGGILIHKQWVLTSAQC---K 79

  Fly   179 ALPTDWRLSGVR--LGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDI 241
            .:|    :|.|.  :|....:         :|.:.....:.::|  :|.       ..|.:.:||
Zfish    80 EVP----VSSVTVLIGSLSLS---------KGSQRIGILNYEIP--KTF-------NEKTKEDDI 122

  Fly   242 ALLRLAQQVEYTDFVRPICLP---LDVNLRSATFDGITMDVAGWG----KTEQLSASNLKLKAAV 299
            .|:||:::|:    .:|..:|   .||.      .|....|.|||    |.||.|.....|:..|
Zfish   123 MLIRLSKKVK----AKPYKIPKNEKDVP------PGTKCVVRGWGTTDYKDEQASDKLQMLEVLV 177

  Fly   300 EGFRMDECQNVYSSQDILLEDTQMCAGG-KEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFG 363
              ...|:|...|:...::.:| .:|||. ::...:|.|||||||    ..|.|    |.||:| |
Zfish   178 --VDRDQCNRYYNRNPVITKD-MLCAGNTQQHRGTCWGDSGGPL----ECKKN----LVGVIS-G 230

  Fly   364 PTPCGLAGWPGVYTLVGK-YVDWIQNTI 390
            ...||:...|.|||.:.| ::.||.:.:
Zfish   231 SQGCGIPKKPTVYTFLSKRHISWINSIL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 77/269 (29%)
Tryp_SPc 128..389 CDD:238113 79/271 (29%)
gzmkXP_017208551.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587395
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.