DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and TPSAB1

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:302 Identity:93/302 - (30%)
Similarity:131/302 - (43%) Gaps:76/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKG-HHCGGSLISTRYVITASHCVNGK 178
            |.|||.  :....|.||.:....::||...:   :..|... |.||||||..::|:||:|||   
Human    20 PAPGQA--LQRVGIVGGQEAPRSKWPWQVSL---RVHGPYWMHFCGGSLIHPQWVLTAAHCV--- 76

  Fly   179 ALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCA-------PPHLD-----VPVERTIPHPDYI 231
                                .||       :||.|       ..||.     :||.|.|.||.:.
Human    77 --------------------GPD-------VKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFY 114

  Fly   232 PASKNQVN-DIALLRLAQQVEYTDFVRPICLPLDVNLRSATF-DGITMDVAGWGKTEQLSASNLK 294
            .|   |:. |||||.|.:.|..:..|..:.||    ..|.|| .|:...|.|||..:  :...|.
Human   115 TA---QIGADIALLELEEPVNVSSHVHTVTLP----PASETFPPGMPCWVTGWGDVD--NDERLP 170

  Fly   295 LKAAVEGFRMDECQN----------VYSSQDI-LLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTN 348
            ....::..::...:|          .|:..|: ::.|..:|||.... |||:|||||||:    .
Human   171 PPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRR-DSCQGDSGGPLV----C 230

  Fly   349 KVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            |||..:..|||||:| ..|.....||:||.|..|:|||.:.:
Human   231 KVNGTWLQAGVVSWG-EGCAQPNRPGIYTRVTYYLDWIHHYV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 87/284 (31%)
Tryp_SPc 128..389 CDD:238113 89/286 (31%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 88/284 (31%)
Tryp_SPc 31..267 CDD:214473 87/283 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.