DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Prss41

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:334 Identity:100/334 - (29%)
Similarity:146/334 - (43%) Gaps:84/334 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VLICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCG--NILSNRIYGGMKTKIDEFPWMALIEY 147
            :|:.|.......|.|.........|...||.:|  ||  |.:.:||.||:::....:||.|.:..
  Rat    12 LLVVCVMLGEPGSREENQAAGLKNTDIKLLSMP--CGRRNDIRSRIVGGIESVRGRWPWQASLRL 74

  Fly   148 TKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGE-------WDTNTNPDCEVD 205
                 :|.|.|||||:|.|:|:||:||......|..|.   |:||:       |    |.:....
  Rat    75 -----RKFHRCGGSLLSHRWVLTAAHCFRKFLDPKKWT---VQLGQLTSKPSFW----NREAFSG 127

  Fly   206 VRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSA 270
            ...:||......|                |.:.:|:||||||..|.|..|::|:|:     |.||
  Rat   128 RYRVKDIIINSED----------------KLKYHDLALLRLASSVTYNKFIQPVCV-----LPSA 171

  Fly   271 TFDGITMD-------VAGWGKTEQLSASNLK--------LKAAVEGFRMDECQNVYS--SQDILL 318
                 :|.       |.|||..::    :||        .:..|....:..||.::|  |:..|:
  Rat   172 -----SMSQHQPRCWVTGWGALQE----DLKPLPPPYHLREVQVTVLNLSRCQELFSFASRYHLI 227

  Fly   319 EDTQMCAGGKEG-VDSCRGDSGGPLI----GLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTL 378
            .....|||.::| .|:|.|||||||:    ||        ::..|:||.| ..||....||:||.
  Rat   228 TRDVFCAGAEDGSADTCSGDSGGPLVCNMDGL--------WYQIGIVSRG-VGCGRPKLPGIYTN 283

  Fly   379 VGKYVDWIQ 387
            |..:.|||:
  Rat   284 VSHHYDWIK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 1/3 (33%)
Tryp_SPc 127..386 CDD:214473 87/287 (30%)
Tryp_SPc 128..389 CDD:238113 88/289 (30%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 87/287 (30%)
Tryp_SPc 55..292 CDD:238113 87/287 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.