DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and zgc:123217

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:303 Identity:81/303 - (26%)
Similarity:138/303 - (45%) Gaps:50/303 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RESSSETTPPPKPNVTSNSLLPLPGQCGNI-LSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHH 157
            ::|:::||                .:||.. |:.||.||.......:||...|.|...     |.
Zfish    18 QDSNAQTT----------------YECGVAPLNTRIVGGTDAPAGSWPWQVSIHYNNR-----HI 61

  Fly   158 CGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVE 222
            |||:||.:::|:||:||:    :.|:..:..:.||....:|:.           ..|..:.|.::
Zfish    62 CGGTLIHSQWVMTAAHCI----INTNINVWTLYLGRQTQSTSV-----------ANPNEVKVGIQ 111

  Fly   223 RTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGW---GK 284
            ..|.||.:..:..|  |||:|::|:|.|.::.::|||||..:   .|..::|.:....||   ||
Zfish   112 SIIDHPSFNNSLLN--NDISLMKLSQPVNFSLYIRPICLAAN---NSIFYNGTSCWATGWGNIGK 171

  Fly   285 TEQLSASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNK 349
            .:.|.|.....:..:.......|...|.|.:......||...||....:|:||||||.    ..|
Zfish   172 DQALPAPQTLQQVQIPVVANSLCSTEYESVNNATITPQMICAGKANKGTCQGDSGGPF----QCK 232

  Fly   350 VNTYYFLAGVVSFGPTP-CGLAGWPGVYTLVGKYVDWIQNTIE 391
            ..:.:..||:.|:|.:. |.:..:|.||:.|.::..||:..::
Zfish   233 QGSVWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWIKMNVQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 73/262 (28%)
Tryp_SPc 128..389 CDD:238113 74/264 (28%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 73/262 (28%)
Tryp_SPc 37..273 CDD:238113 74/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.