DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG18754

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:383 Identity:122/383 - (31%)
Similarity:175/383 - (45%) Gaps:76/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QFYFPNEAAQVPNYGRCITPNRERALCIHLEDCKYLYGLLTTTPLRDTDRLYLSRSQCGY-TNG- 83
            |..|.|:.|:......|    ::...|..|..|..|..:|....:...::...:..|||. .|| 
  Fly    14 QAIFFNQLAECVRLSSC----QKDEKCTRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGH 74

  Fly    84 ----KVLICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCGN---ILSNRIYGGMKTKIDEFPW 141
                .|.:|||:                  ...:||....||.   :..:|  |....:::|:||
  Fly    75 ELLHMVYVCCPE------------------LGDVLPNKQTCGQTTPVFRDR--GAENAELNEYPW 119

  Fly   142 MALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKAL-PTDWRLSGVRLGEWDTNTNPDCEVD 205
            |.|:.|....         |||  |||:||:|||.|..| ..|..|..|||||..|    ||   
  Fly   120 MVLLLYENRL---------SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTT----DC--- 166

  Fly   206 VRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICL-----PL-D 264
            :.....|  |||||.|.:|..|..:..:.....||||||||...|.||..::||||     || |
  Fly   167 ITSESRC--PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQD 229

  Fly   265 VNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKE 329
            :||:          ::||..|:   :|...:.:.|:.....:|.|.|.|   ....:|:||||:.
  Fly   230 LNLQ----------ISGWDPTK---SSQTLITSTVKERNPADCLNRYPS---FRSASQVCAGGQR 278

  Fly   330 GVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQ 387
            ..|:|.|.||.|::|:..:.|:.:.||||:.|:|...|..||.|||||.:|.:.:||:
  Fly   279 KGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 12/57 (21%)
Tryp_SPc 127..386 CDD:214473 97/265 (37%)
Tryp_SPc 128..389 CDD:238113 98/267 (37%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 11/48 (23%)
Tryp_SPc 108..338 CDD:238113 98/265 (37%)
Tryp_SPc 108..335 CDD:214473 96/262 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.