DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG18735

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:301 Identity:105/301 - (34%)
Similarity:149/301 - (49%) Gaps:47/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ESSSETTPPPKPNVTSNSLLPLPGQCGNI-LSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHC 158
            |..:|.:.|.|......|       |||| ..:||.||.:|::.|:|||.::.:..:     .:|
  Fly    56 EVPAEWSSPAKRECAECS-------CGNINTRHRIVGGQETEVHEYPWMIMLMWFGN-----FYC 108

  Fly   159 GGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVER 223
            |.||::.:|.:||:|||||    ...||..|||.|   :...|..|.:          :|..|.|
  Fly   109 GASLVNDQYALTAAHCVNG----FYHRLITVRLLE---HNRQDSHVKI----------VDRRVSR 156

  Fly   224 TIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGK-TEQ 287
            .:.||.|  :::|..:||||:|..:.|.....:.|:|:|..    |..:.|.|..|.|||. :|.
  Fly   157 VLIHPKY--STRNFDSDIALIRFNEPVRLGIDMHPVCMPTP----SENYAGQTAVVTGWGALSEG 215

  Fly   288 LSASNLKLKAAVEGFRMDECQNV-YSSQDILLEDTQMCAGGKE--GVDSCRGDSGGPLIGLDTNK 349
            ...|:...:..|.....:||:|. |....|  .|..:|||..|  |.|||:||||||:..|.:..
  Fly   216 GPISDTLQEVEVPILSQEECRNSNYGESKI--TDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGD 278

  Fly   350 VNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI-QNT 389
            .   |.|||:||:| ..|.....|||||.||.:.||| :||
  Fly   279 A---YQLAGIVSWG-EGCAKPNAPGVYTRVGSFNDWIAENT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 92/262 (35%)
Tryp_SPc 128..389 CDD:238113 93/265 (35%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/262 (35%)
Tryp_SPc 83..314 CDD:238113 93/264 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.