DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:318 Identity:98/318 - (30%)
Similarity:139/318 - (43%) Gaps:76/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RESSSETTPPPKPNVTSNSLLPLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHC 158
            |:|.|......:||.|              |:.||.||:......:|||..:     ||:.||.|
Zfish    16 RDSLSNLQVCGRPNPT--------------LNPRIVGGVNATHGAWPWMVSL-----QGRYGHFC 61

  Fly   159 GGSLISTRYVITASHCVNGKALPTDWRLSG--VRLGEW-----DTNTNPDCEVDVRGMKDCAPPH 216
            |||||:.::|:||:||:      .|...|.  |.||:|     |.|:                  
Zfish    62 GGSLINNQWVLTAAHCI------VDQTPSSIIVYLGKWRSYVADVNS------------------ 102

  Fly   217 LDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFD-GITMDVA 280
            :...:...||||.|...:|:  ||||||:|...|:|||:::|||| .|.|   :.|. |....||
Zfish   103 ISRTIRHIIPHPSYSNITKD--NDIALLQLTSTVQYTDYIKPICL-ADEN---SNFPRGTNSWVA 161

  Fly   281 GWGKTEQLSASNLKLKAAVE------GFRMDECQNVYSSQDI------LLEDTQMCAGGKEGVDS 333
            |||....|....::.:..|.      |...:....|||:.|.      .:....:|||.:.|..:
Zfish   162 GWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHGRITPNMICAGTRPGGKA 226

  Fly   334 C-RGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            . .|||||||:    .|.:. :..|||:|.| ..|.....|.|:..|.:|..||...:
Zfish   227 TFSGDSGGPLM----TKCSV-WVQAGVLSHG-YGCAQPNLPEVFIRVSEYKQWITGNV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 89/279 (32%)
Tryp_SPc 128..389 CDD:238113 90/281 (32%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 88/278 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.