DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and PRSS8

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:284 Identity:92/284 - (32%)
Similarity:140/284 - (49%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 CGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDW 184
            ||.....||.||......::||...|.|   :|.  |.|||||:|.::|::|:||     .|::.
Human    37 CGVAPQARITGGSSAVAGQWPWQVSITY---EGV--HVCGGSLVSEQWVLSAAHC-----FPSEH 91

  Fly   185 RLSG--VRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLA 247
            ....  |:||....::..: :..|..:||            .||||.|:  .:....|||||:|:
Human    92 HKEAYEVKLGAHQLDSYSE-DAKVSTLKD------------IIPHPSYL--QEGSQGDIALLQLS 141

  Fly   248 QQVEYTDFVRPICLPLDVNLRSATF-DGITMDVAGWGKTEQLSASNLKLK----AAVEGFRMDEC 307
            :.:.::.::||||||    ..:|:| :|:...|.|||.... |.|.|..|    ..|.....:.|
Human   142 RPITFSRYIRPICLP----AANASFPNGLHCTVTGWGHVAP-SVSLLTPKPLQQLEVPLISRETC 201

  Fly   308 QNVYS-----SQDILLEDTQMCAGGKE-GVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTP 366
            ..:|:     .:...:::..:|||..| |.|:|:|||||||    :..|...::|.|:||:|.. 
Human   202 NCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPL----SCPVEGLWYLTGIVSWGDA- 261

  Fly   367 CGLAGWPGVYTLVGKYVDWIQNTI 390
            ||....||||||...|..|||:.:
Human   262 CGARNRPGVYTLASSYASWIQSKV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 87/271 (32%)
Tryp_SPc 128..389 CDD:238113 89/273 (33%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 87/271 (32%)
Tryp_SPc 45..284 CDD:238113 89/273 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.