DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and zgc:112038

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:288 Identity:89/288 - (30%)
Similarity:137/288 - (47%) Gaps:60/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 CGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHC------VNGK 178
            ||....|...||.......:||.|.|.....:   .|.||||||:..:|::|:||      .|.|
Zfish    27 CGQAPLNNNNGGDDAVAGSWPWQASIHRISPE---DHICGGSLINKDWVLSAAHCFMITATANIK 88

  Fly   179 ALPTDWRLSGVRLG-EWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIP----HPDYIPASKNQV 238
                      :.|| ::.|.:||:                  .:.||:.    ||||...::|  
Zfish    89 ----------IFLGRQFQTGSNPN------------------EISRTLTQIVIHPDYSTTTQN-- 123

  Fly   239 NDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMD-VAGWGK--TEQLSASNLKLKAAVE 300
            ||||||||:..|.:||::||:||.    ...:.|.|.|.. :.||.|  :..:..:|:..:..:.
Zfish   124 NDIALLRLSSSVTFTDYIRPVCLA----SADSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLP 184

  Fly   301 GFRMDECQNVYSSQDILLEDTQMCAGGKE-GVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGP 364
            .....||...|..   ::.|..:|||..| |.|:|:||||||::..:.::    :..:|:|||| 
Zfish   185 VVSNTECNADYKG---IITDNMICAGINEGGKDACQGDSGGPMVSQNGSR----WIQSGIVSFG- 241

  Fly   365 TPCGLAGWPGVYTLVGKYVDWIQNTIES 392
            ..|||..:||:||.|.:|..||.:.:.:
Zfish   242 RECGLPRYPGIYTRVSQYQSWITSELRT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 84/273 (31%)
Tryp_SPc 128..389 CDD:238113 86/275 (31%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 84/270 (31%)
Tryp_SPc 37..263 CDD:238113 84/270 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.