DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and f10

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001015728.1 Gene:f10 / 548445 XenbaseID:XB-GENE-971433 Length:464 Species:Xenopus tropicalis


Alignment Length:358 Identity:95/358 - (26%)
Similarity:157/358 - (43%) Gaps:89/358 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 CGYTNGKVL-----ICCP-DRY-----------RESS------------------SETTPPPKPN 107
            |..|||.:|     .|.| ::|           ||:.                  ::|...|:.|
 Frog   148 CSCTNGYILGENGKSCLPTEKYSCGRRHMKRERRETKLHENDKKNHTDSQNEVKMNQTGTLPERN 212

  Fly   108 VTS-NSLLPLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITA 171
            ||. |.|.|      |..:.||.||.:....|.||.||:...:.:|    .|||:::|..:::||
 Frog   213 VTGINILNP------NDPNVRIVGGRECSQGECPWQALLVSDEDEG----FCGGTILSREFILTA 267

  Fly   172 SHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKN 236
            :||:|      ..:...|.:||.:|..:...|...:             ||:.|.||.::.::.:
 Frog   268 AHCMN------QTKYFKVVVGELNTKISEGTESIHK-------------VEKIIMHPRFVKSTYD 313

  Fly   237 QVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMD-----VAGWGKTEQ--LSASNLK 294
            .  |||:::|.:.:.:|:.:.|.|:| |....    |.:.|:     |:|:|:..:  ..||.|:
 Frog   314 Y--DIAVIKLKEAINFTENIIPACIP-DPEFA----DQVLMNEPDAMVSGFGRIHERGRQASTLQ 371

  Fly   295 LKAAVEGFRMDECQNVYSSQDILLEDTQMCAG-GKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAG 358
            : ..|...:...|:   .|....:.:...||| ..|..|:|:||||||.:    ......||:.|
 Frog   372 M-LQVPYIKRHSCK---ESSTFAITENMFCAGFDTEVKDACQGDSGGPHV----TPFKGTYFVTG 428

  Fly   359 VVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIE 391
            :||:| ..|...|..||||.|.|...|::..::
 Frog   429 IVSWG-EGCARKGKFGVYTKVSKLHRWLKGVLK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 5/15 (33%)
Tryp_SPc 127..386 CDD:214473 75/266 (28%)
Tryp_SPc 128..389 CDD:238113 75/268 (28%)
f10NP_001015728.1 GLA 22..84 CDD:214503
EGF_CA 85..121 CDD:238011
FXa_inhibition 128..163 CDD:373209 5/14 (36%)
Tryp_SPc 228..456 CDD:238113 75/266 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.