DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and zgc:92313

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:300 Identity:91/300 - (30%)
Similarity:135/300 - (45%) Gaps:77/300 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 QCGN-ILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHH-CGGSLISTRYVITASHCVNGKALP 181
            :||. .:.|||.||.......:||...|     ||:|..| |||::||..:|::|:||...   |
Zfish    25 ECGRPPMINRIVGGSSAADGAWPWQVDI-----QGEKSKHVCGGTIISENWVLSAAHCFPN---P 81

  Fly   182 TDWRLSGV-------RLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVN 239
            .|  :||.       :|..|    ||| |...|             :.|.:....|......|  
Zfish    82 ND--ISGYLIYAGRQQLNGW----NPD-ETSHR-------------ISRVVVPLGYTDPQLGQ-- 124

  Fly   240 DIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMD----VAGWGKTEQLSASNLKLKAAVE 300
            ||||:.||....||:.::|:|||. .|:.      .|.|    :.|||        :::...|::
Zfish   125 DIALVELATPFVYTERIQPVCLPY-ANVE------FTSDMRCMITGWG--------DIREGVALQ 174

  Fly   301 GFR---------MDE--CQNVY---SSQDILLEDTQMCAGGKE-GVDSCRGDSGGPLIGLDTNKV 350
            |..         :|.  ||:::   .:::|.:....||||.:: |.|||:|||||||.   ....
Zfish   175 GVGPLQEVQVPIIDSQICQDMFLTNPTENIDIRPDMMCAGFQQGGKDSCQGDSGGPLA---CQIS 236

  Fly   351 NTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            :..:..||:|||| ..|..|..||||..|..:.::||..:
Zfish   237 DGSWVQAGIVSFG-LGCAEANRPGVYAKVSSFTNFIQTHV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 86/285 (30%)
Tryp_SPc 128..389 CDD:238113 87/287 (30%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 86/285 (30%)
Tryp_SPc 35..274 CDD:238113 87/287 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.