DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and aqrs

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:216 Identity:52/216 - (24%)
Similarity:88/216 - (40%) Gaps:60/216 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 CGGSLISTRYVITASHCVNGKALPTDWR--------LSGVRLGEWDTNTNPDCEVDVRGMKDCAP 214
            |.|:|||.|.|:|::||...:.....:.        |:||.|.:     ||:             
  Fly    89 CAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDD-----NPE------------- 135

  Fly   215 PHLDVPVERTIPHPDYIPASKNQ--VNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITM 277
            ||..:..        ::|.:||:  .|.:|||.|:.::: .|..|.|  ||.   |.....|..:
  Fly   136 PHQVIGF--------FMPVNKNERFTNYVALLALSNKLD-RDKYRYI--PLH---RKKPQAGDDV 186

  Fly   278 DVAGWGKTE-QLSASNLKLKAAVEGFRMDECQNVYSSQDIL----LEDTQMCAGGK--EGVDSCR 335
            .:|.:|..: |:...|.::      ..:|.|:..|..:::.    .|...:|...|  ....:|.
  Fly   187 KMAYYGPPKFQIRLYNTRV------MDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTTCS 245

  Fly   336 GDSGGPLIGLDTNK---VNTY 353
            ...|.||: :| ||   :|.|
  Fly   246 TRPGDPLL-ID-NKLAAINIY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 52/216 (24%)
Tryp_SPc 128..389 CDD:238113 52/216 (24%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 52/216 (24%)
Tryp_SPc 83..268 CDD:304450 52/216 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.