DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG5909

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:386 Identity:114/386 - (29%)
Similarity:184/386 - (47%) Gaps:60/386 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 CITPNRERALCIHLEDCKY------LYGLLTTTPLRDTDRL---YLSRSQC-GYTNGKVL-ICCP 90
            |:||.:....||..::|.:      :||       |:..|.   .:|..|| ..||.:.. :|||
  Fly    25 CVTPAQAAGQCIRYQECPFVQKILGIYG-------RNIPRKIHNQISEMQCRSTTNTRDFHLCCP 82

  Fly    91 DRYRESSSETTPPPKPNVTSN-------------------SLLPLPGQCGNILSNRIYGGMKTKI 136
            :.         .||:.|..|.                   .||.....|||..:.::.||...:.
  Fly    83 NE---------APPQSNQESQRKVVRSEGGNLNRYDRQGLQLLNSVTNCGNKGNPKVSGGKTARP 138

  Fly   137 DEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPD 201
            .:|||:||::| |....:...|||||||.|:::||:||:..:.     .:..|||||.|..:..|
  Fly   139 GDFPWVALLKY-KINDPRPFRCGGSLISERHILTAAHCIIDQP-----EVIAVRLGEHDLESEED 197

  Fly   202 CEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVN 266
            |.......:.|.||:.:..:|:...||:|:....:  :|:|:::|.:.|:....::|:|||:|..
  Fly   198 CHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKIS--HDVAIIKLDRVVKEKSHIKPVCLPIDQK 260

  Fly   267 LRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGV 331
            .:...||. :..|||||.||:.:.:....:|.:....::||:..|:..::  .|..:||.|....
  Fly   261 SQELDFDQ-SFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGEV--SDNHICATGTGIK 322

  Fly   332 DSCRGDSGGPLIGLDTNKVNTYYFLA-GVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIE 391
            .:|:||||||:......| |||..:. ||||||...|| ...|||:..|...:.||...::
  Fly   323 HTCQGDSGGPVFFKHRFK-NTYRVVQYGVVSFGGRLCG-QNQPGVFASVIDMLPWITQNLQ 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 15/62 (24%)
Tryp_SPc 127..386 CDD:214473 85/259 (33%)
Tryp_SPc 128..389 CDD:238113 87/261 (33%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829 16/63 (25%)
Tryp_SPc 129..376 CDD:214473 85/259 (33%)
Tryp_SPc 132..379 CDD:238113 87/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.920

Return to query results.
Submit another query.