DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and grass

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:408 Identity:138/408 - (33%)
Similarity:202/408 - (49%) Gaps:50/408 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKPSIICLFLGILAKSSAGQFYFPNEAAQVPNYGRCITPNRERALCIHLEDCKYLYGLLTTTPL 65
            |:..|.:.:..||...||.|.     ::|:......|.||:.::..|:....|:.:...||....
  Fly     1 MMIASSLAVLYGIAIVSSMGV-----QSARADYADDCTTPDGDQGQCMPFSSCRTIEERLTEAQK 60

  Fly    66 RDTD-----RLYLSRSQCGYTNGKVLICCPDRYRESSSETTPPPKPNVTSNS-LLPL----PGQC 120
            ....     ..||.::.||..||....||              |..|:..|| ::.|    ...|
  Fly    61 AGQKVPADYASYLQKALCGEFNGVRHFCC--------------PSANIQHNSKVMSLFKDENFDC 111

  Fly   121 GNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWR 185
            ||.||.|:..|.:.|:...|||||:.| :..|:....|||::||.||::||:|||:|  |..|  
  Fly   112 GNFLSQRVSNGYEVKLSSRPWMALLRY-QQFGESRFLCGGAMISERYILTAAHCVHG--LQND-- 171

  Fly   186 LSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQV 250
            |..:||||...:|..||....| .|.||||.::|.:|:.:.|..|  .:::.::|||||:|.:.|
  Fly   172 LYEIRLGEHRISTEEDCRQQGR-KKKCAPPVVNVGIEKHLIHEKY--DARHIMHDIALLKLNRSV 233

  Fly   251 EYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDECQNVYSSQD 315
            .:...::|||||:...|:.......|..|.|||.||..|:|::.|:|.|.......|...|....
  Fly   234 PFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYRRAV 298

  Fly   316 ILLEDTQMCAGGKEGVDSCRGDSGGPL------IGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPG 374
            .|   :|:|.||.:..|||:|||||||      :|....|:..:    |:||.|...||....||
  Fly   299 PL---SQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEF----GIVSQGVVTCGQISLPG 356

  Fly   375 VYTLVGKYVDWIQNTIES 392
            :||.||:||.||.:|:.|
  Fly   357 LYTNVGEYVQWITDTMAS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 13/56 (23%)
Tryp_SPc 127..386 CDD:214473 101/264 (38%)
Tryp_SPc 128..389 CDD:238113 102/266 (38%)
grassNP_651543.1 CLIP 32..90 CDD:197829 15/71 (21%)
Tryp_SPc 121..371 CDD:238113 102/264 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.