DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG11836

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:294 Identity:106/294 - (36%)
Similarity:156/294 - (53%) Gaps:54/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SNSLLPLPGQCGNILSN---RIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITA 171
            ::||......||  .||   ||.||..|.::::||||.|.|   .||  .||||||::..||::|
  Fly    78 NSSLKNCDCDCG--FSNEEIRIVGGKPTGVNQYPWMARIVY---DGK--FHCGGSLLTKDYVLSA 135

  Fly   172 SHCVNGKALPTDWRLSGVRL--GEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPAS 234
            :|||  |.|    |.|.:|:  |:.|.....:.:...|.            |...|.|..:.|.:
  Fly   136 AHCV--KKL----RKSKIRVIFGDHDQEITSESQAIQRA------------VTAVIKHKSFDPDT 182

  Fly   235 KNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFD--GITMDVAGWGKTE---QLSASNLK 294
            .|  ||||||||.:.:.::..::|||||      ...:|  |....|.|||:|.   :|.:...:
  Fly   183 YN--NDIALLRLRKPISFSKIIKPICLP------RYNYDPAGRIGTVVGWGRTSEGGELPSIVNQ 239

  Fly   295 LKAAVEGFRMDECQNV-YSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAG 358
            :|..:  ..:.||:|. |.|..|  ..:.:|| |:..:|||:|||||||  |.:|.|.  ||:.|
  Fly   240 VKVPI--MSITECRNQRYKSTRI--TSSMLCA-GRPSMDSCQGDSGGPL--LLSNGVK--YFIVG 295

  Fly   359 VVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIES 392
            :||:| ..||..|:||||:.|.|::.||::.:|:
  Fly   296 IVSWG-VGCGREGYPGVYSRVSKFIPWIKSNLEN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 97/266 (36%)
Tryp_SPc 128..389 CDD:238113 98/268 (37%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 98/268 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.