DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG31219

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:354 Identity:119/354 - (33%)
Similarity:180/354 - (50%) Gaps:59/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IHLEDCKYLYGL-LTTTPLRDTDR----LYLSRSQCGYTNGKVLICCPDRYRESSSETTPPPKPN 107
            ::|.:|.::|.. .:.|.:|:.|.    |:..|           |||            |||   
  Fly    32 VYLYECPHVYTAGRSRTLMREYDMDAWLLFGQR-----------ICC------------PPP--- 70

  Fly   108 VTSNSLLPLPGQCGNILSN-RIYGGMKTKIDEFPWMALIEYTKSQGKK-GHHCGGSLISTRYVIT 170
               .:.||....||..||. |:.||.:.:.:.:||||::.|..:...: ...|.||||:.|||:|
  Fly    71 ---GNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRYVLT 132

  Fly   171 ASHCVNGKALPTDWRLSGVRLGE----WDTNTNPDC-EVDVRGMKDCAPPHLDVPVERTIPHPDY 230
            ::|||||  :|.|..|..|||||    :|...|||| :.|    ..||.|:|::.:|:.|.|..:
  Fly   133 SAHCVNG--IPRDLSLKSVRLGEHDITYDPAYNPDCRDQD----NQCALPNLEIKLEKIIVHGLF 191

  Fly   231 IPASKNQVN-DIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLK 294
            ...|...:. |||||||...|.|...:.|||:|     :...|....:::||||||.:...|.:.
  Fly   192 SSISNRNIEYDIALLRLKMPVRYRTGIMPICIP-----KHGFFAKSKLEIAGWGKTNEGQFSQVL 251

  Fly   295 LKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPL-IGLDTNKVNTYYFLAG 358
            :...:....:..|...:...| |.:..|:||||.:|||:|:||||||| :.:|.:.|    :|||
  Fly   252 MHGFIRERSIAVCALRFPYLD-LNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSV----YLAG 311

  Fly   359 VVSFGPTPCGLAGWPGVYTLVGKYVDWIQ 387
            :.::|...||..|.||:||....::.||:
  Fly   312 ITTYGSKNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 9/45 (20%)
Tryp_SPc 127..386 CDD:214473 97/266 (36%)
Tryp_SPc 128..389 CDD:238113 98/268 (37%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 97/266 (36%)
Tryp_SPc 90..342 CDD:238113 98/267 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.