DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG7142

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:408 Identity:94/408 - (23%)
Similarity:155/408 - (37%) Gaps:112/408 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SIICLFLGILAKSSAGQFYFPNEAAQVPNYGRC---ITPNRERALCIHLEDCKYLYGLL-----T 61
            |.|...:.:|:.:|:|       :.|:|...:|   .:......:.::|.    .||||     |
  Fly    14 STIASIMVVLSSASSG-------SIQLPTVRKCGGGRSAGAAHTMAMNLA----AYGLLENRIST 67

  Fly    62 TTPLRDTDRLYLSRSQCGYTNGKVLICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCGNILSN 126
            ....|.|           :...|.|         :..|.||...|.|.|..::            
  Fly    68 LEAPRQT-----------HWTKKFL---------AKREATPHSAPYVVSIQMM------------ 100

  Fly   127 RIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRL 191
                                 |..||.. |:|.|::|:..:::||:||::.   |.....|.:..
  Fly   101 ---------------------TPDQGLV-HYCAGTIINEHWILTAAHCLSS---PQAVENSVIVA 140

  Fly   192 GEWDTNTNPDCEVDVRG-MKDCAPPHLDVPVERTIPHPDYIPASKNQVN--DIALLRLAQQVEYT 253
            |..|.:       |.:| ..:....|:|..|.    |..|:    ..||  ||||:...:.:.:.
  Fly   141 GSHDIH-------DQKGEASNIQMRHIDYYVR----HELYL----GGVNPYDIALIYTKEPLVFD 190

  Fly   254 DFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNL--KLKAA-VEGFRMDECQNVYSSQD 315
            .:|:|..||    .:.|..:|.. .:.|||.....:..|.  :|:.| :....|:.|:.:.:...
  Fly   191 TYVQPATLP----EQDAQPEGYG-TLYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSG 250

  Fly   316 ILLEDTQMCAGG-KEGVDSCRGDSGGPLIGLDTNKVNTYYF-----LAGVVSFGPTPCGLAGWPG 374
            :.|.:|.:|.|. ..||..|..|||||||    .:....:|     :.|:||:|..|||....|.
  Fly   251 LPLHETNLCTGPLTGGVSICTADSGGPLI----QQCCEEHFEQANIVIGIVSWGKMPCGQKNAPS 311

  Fly   375 VYTLVGKYVDWIQNTIES 392
            |:..|..:.:||...|.:
  Fly   312 VFVRVSAFTEWINQVIST 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 11/59 (19%)
Tryp_SPc 127..386 CDD:214473 67/270 (25%)
Tryp_SPc 128..389 CDD:238113 69/272 (25%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 75/302 (25%)
Tryp_SPc 84..323 CDD:214473 73/299 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.