DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG8870

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:358 Identity:113/358 - (31%)
Similarity:172/358 - (48%) Gaps:58/358 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CIHLEDCKYLYGLLTTTPLRDTDRLYLSRSQCGYTNGKVLICCPDRYRESSSETTPPPKPNVTSN 111
            |::|:.|.     .|...:..:.:..:...:|| ||   .:|||      ..||..|        
  Fly    32 CVNLDKCP-----RTRAVMNSSRKNIIGLRRCG-TN---KVCCP------KWETYLP-------- 73

  Fly   112 SLLPLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGH-------HCGGSLISTRYVI 169
                 ...||........|.:.. ::||||||::.|    |.|.:       .||||||:..||:
  Fly    74 -----HDTCGQSRRKPTKGKIPA-LNEFPWMAMLLY----GNKNNLSQKLVPKCGGSLINNWYVL 128

  Fly   170 TASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPAS 234
            ||:|||....:...:.|..|||||.:|:||||..: |.|.:..||.::::.|::.|.|..: ...
  Fly   129 TAAHCVEYPFMDYPYALKTVRLGEHNTSTNPDRAI-VNGRRQYAPLYMEIEVDQIITHEQF-NRG 191

  Fly   235 KNQVNDIALLRLAQQVEYTDFVRPICLP----LDVNLRSATFDGITMDVAGWGKTEQLSASNLKL 295
            :..:|||||:||...|.||..::|||||    |..:.|.       ...:||....|..||.:.|
  Fly   192 RRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRK-------FQASGWPDMGQGIASEVLL 249

  Fly   296 KAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVV 360
            ::.:.....|.|::.|   |..| .:|:||||.:|.|:..|||||||:........|..:.||::
  Fly   250 RSFIAERHPDVCKSNY---DFNL-GSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGII 310

  Fly   361 SFGPTPCGLAGW-PGVYTLVGKYVDWIQNTIES 392
            |:|..||.|... |..||....:.:||::.::|
  Fly   311 SYGQKPCVLKTCKPAFYTKTSYFFEWIKSKLQS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 8/41 (20%)
Tryp_SPc 127..386 CDD:214473 94/270 (35%)
Tryp_SPc 128..389 CDD:238113 96/272 (35%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 95/263 (36%)
Tryp_SPc 93..337 CDD:214473 93/260 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.