DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG3916

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:312 Identity:74/312 - (23%)
Similarity:123/312 - (39%) Gaps:100/312 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VTSNSLLPLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITAS 172
            |||.:..|          .||.||.:.. :..|:...::..: :|:..|.||||::|.::|:||:
  Fly    21 VTSTTESP----------TRINGGQRVN-ETVPFQVSLQMQR-RGRWQHFCGGSIVSGQHVLTAA 73

  Fly   173 HCVNGKAL--------PTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIP--- 226
            ||:....:        ..:|:..|:|                               .|.:.   
  Fly    74 HCMEKMKVEDVSVVVGTLNWKAGGLR-------------------------------HRLVTKHV 107

  Fly   227 HPDYIPASKNQ--VNDIALLRLAQ--QVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKT-- 285
            ||.|   |.|.  :|||||:::..  ::|.:|....:     :.......:.:.:.:.|||.|  
  Fly   108 HPQY---SMNPRIINDIALVKVTPPFRLERSDISTIL-----IGGSDRIGEKVPVRLTGWGSTSP 164

  Fly   286 --------EQLSASNLKL----KAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDS 338
                    :||.|.|.:.    ....:|||:..              .::||...:|..:|.|||
  Fly   165 STSSATLPDQLQALNYRTISNEDCNQKGFRVTR--------------NEICALAVQGQGACVGDS 215

  Fly   339 GGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            |||||     :......|.|:||:|.:.|. .|.|.|||.|..::.:|...|
  Fly   216 GGPLI-----RPGKQPHLVGIVSYGSSTCA-QGRPDVYTRVSSFLPYISQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 68/287 (24%)
Tryp_SPc 128..389 CDD:238113 68/289 (24%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 68/287 (24%)
Tryp_SPc 31..260 CDD:238113 68/289 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.