DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG17404

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:312 Identity:82/312 - (26%)
Similarity:130/312 - (41%) Gaps:80/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LLPLPGQCGNILS--------NRIYGGMKTKIDE-FPWMALIEYTKSQGKKGHHCGGSLISTRYV 168
            ::.|.|..|.:.|        :||.||......| .|:...::| :::|.:.|.||||:|:...:
  Fly    12 VVALGGVFGRLNSRQPSGYTPHRIVGGADIPPGEHVPYQVSLQY-RTRGGQMHFCGGSIIAPNRI 75

  Fly   169 ITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGM--KDCAPPHLDVPVERTIPHPDYI 231
            :||:||..|        |:..|:         .....:||:  |......|...:     ||.| 
  Fly    76 LTAAHCCQG--------LNASRM---------SVVAGIRGLNEKGSRSQVLSYSI-----HPKY- 117

  Fly   232 PASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVN--------LRSATFD----GITMDVAGWGK 284
              .:...:|:|:|.          ::|   ||.:|        .||...|    |:.:.:.|||.
  Fly   118 --QELVTSDLAVLS----------IKP---PLKLNNSTISAIEYRSQGKDFVGGGVPVTLTGWGL 167

  Fly   285 --------TEQLSASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGK-EGVDSCRGDSGG 340
                    .:.::..|:..:.:.......||:|.....   :.||::||.|. .|  :|.|||||
  Fly   168 RLPVPFPFLDNVNYPNVLQRMSYHTISNSECRNAGMES---VTDTEICARGPFRG--ACSGDSGG 227

  Fly   341 PLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIES 392
            ||:....|.:..    .|:||:|...|||...|.|||.|..:.|||.|..:|
  Fly   228 PLVMESKNGLQQ----VGIVSYGLVVCGLYISPDVYTRVSTFSDWIGNQTKS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 74/282 (26%)
Tryp_SPc 128..389 CDD:238113 75/284 (26%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 74/282 (26%)
Tryp_SPc 35..269 CDD:238113 73/281 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.