DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and MP1

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:379 Identity:189/379 - (49%)
Similarity:247/379 - (65%) Gaps:24/379 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YGRCITPNRERALCIHLEDCKYLYGLLTTTPLRDTDRLYLSRSQCGYTNGKVL----------IC 88
            :|.|.||:.....||:|.:|.||:.||.:..:.:.||.:|..|||||.||:||          ||
  Fly    26 FGYCRTPDENSGTCINLRECGYLFELLQSEEVTEQDRRFLQASQCGYRNGQVLEKHFCFTNVQIC 90

  Fly    89 CPD-RYRESS---------SETTPPPKPNVTSNSLLPLPGQCGNILSNRIYGGMKTKIDEFPWMA 143
            |.: |.|...         ::||.|.|.:.|  .|||:...||....:|:.||.:|...||||||
  Fly    91 CANSRMRNQQPQWGNHPQPTQTTKPTKRSGT--KLLPMAPNCGENFGDRVVGGNETTKREFPWMA 153

  Fly   144 LIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRG 208
            ||||||....||||||||||:.|||:||:|||:  |:|:||.|:||||||||.:|||||.|...|
  Fly   154 LIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVS--AIPSDWELTGVRLGEWDASTNPDCTVGKNG 216

  Fly   209 MKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFD 273
            .:||..|::|.|||..||||.|...|::|:||||||||..:|:|:||:.|:|||...:..:..|.
  Fly   217 RRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFL 281

  Fly   274 GITMDVAGWGKTEQLSASNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDS 338
            |..:.|||||:||....||:||||.::.....||...|::|...:...||||||.||||||||||
  Fly   282 GRKVVVAGWGRTETNFTSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDS 346

  Fly   339 GGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTIES 392
            ||||:..|.:..|:.|::|||||:|||||||.|||||||.|..|::||:|.:.:
  Fly   347 GGPLLLEDYSNGNSNYYIAGVVSYGPTPCGLKGWPGVYTRVEAYLNWIENNVRA 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 24/61 (39%)
Tryp_SPc 127..386 CDD:214473 147/258 (57%)
Tryp_SPc 128..389 CDD:238113 148/260 (57%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855 24/61 (39%)
Tryp_SPc 137..394 CDD:214473 147/258 (57%)
Tryp_SPc 138..397 CDD:238113 148/260 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I19266
eggNOG 1 0.900 - - E33208_3BI1K
Homologene 1 1.000 - - H133329
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.