DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG9372

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:368 Identity:117/368 - (31%)
Similarity:174/368 - (47%) Gaps:62/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NYGRCITPNRERALCIHLEDCKYLYGLLTTTPLRDTDRLYLSRSQCGYTNGKVLICCPDRYRESS 97
            :||.|.||..|...|.|:..|:        .|....|...|....|......:.|||.|   :|:
  Fly    83 DYGACSTPLGESGRCRHIIYCR--------MPELKNDVWRLVSQLCIIEKSSIGICCTD---QST 136

  Fly    98 SETTPP--------PKPNVTSNSLLPLPGQCGNILSN---RIYGGMKTKIDEFPWMALIEYTKSQ 151
            |....|        .:|.:.:.   |....|| |.|.   |:.||...:.||:||||.:   ..:
  Fly   137 SNRFSPQVVTSADGDEPRIVNK---PEQRGCG-ITSRQFPRLTGGRPAEPDEWPWMAAL---LQE 194

  Fly   152 GKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPH 216
            |.....|||.||:.|:|:||:||:..|.....:    |||||:  ||:...|...|         
  Fly   195 GLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIF----VRLGEY--NTHMLNETRAR--------- 244

  Fly   217 LDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAG 281
             |..:...:.|.||.|  :|..||||::|:.:...:..::.|:|:| .||...:..:.|   |.|
  Fly   245 -DFRIANMVLHIDYNP--QNYDNDIAIVRIDRATIFNTYIWPVCMP-PVNEDWSDRNAI---VTG 302

  Fly   282 WGKTEQLSA--SNLKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKE-GVDSCRGDSGGPLI 343
            || |::...  ||:.::..:..::..:|::.:...   :.||.||||..| |.|||:|||||||:
  Fly   303 WG-TQKFGGPHSNILMEVNLPVWKQSDCRSSFVQH---VPDTAMCAGFPEGGQDSCQGDSGGPLL 363

  Fly   344 GLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI 386
               ....|..:...|:||:| ..||..|.||:||.|.:|:|||
  Fly   364 ---VQLPNQRWVTIGIVSWG-VGCGQRGRPGIYTRVDRYLDWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 12/51 (24%)
Tryp_SPc 127..386 CDD:214473 89/261 (34%)
Tryp_SPc 128..389 CDD:238113 90/262 (34%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829 13/52 (25%)
Tryp_SPc 173..402 CDD:214473 89/261 (34%)
Tryp_SPc 176..402 CDD:238113 88/258 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.