DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and KLK1

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_002248.1 Gene:KLK1 / 3816 HGNCID:6357 Length:262 Species:Homo sapiens


Alignment Length:296 Identity:81/296 - (27%)
Similarity:123/296 - (41%) Gaps:87/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 LSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSG 188
            :.:||.||.:.:....||.|.:.:..:     ..|||.|:..::|:||:||::     .:::|  
Human    21 IQSRIVGGWECEQHSQPWQAALYHFST-----FQCGGILVHRQWVLTAAHCIS-----DNYQL-- 73

  Fly   189 VRLGEW--------DTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDY---------IPASKN 236
                 |        |.||..                 .|.|..:.|||.:         ..|.::
Human    74 -----WLGRHNLFDDENTAQ-----------------FVHVSESFPHPGFNMSLLENHTRQADED 116

  Fly   237 QVNDIALLRLAQQVE-YTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTE--------QLSASN 292
            ..:|:.||||.:..: .||.|:.:.||.:     ....|.|...:|||..|        .|...:
Human   117 YSHDLMLLRLTEPADTITDAVKVVELPTE-----EPEVGSTCLASGWGSIEPENFSFPDDLQCVD 176

  Fly   293 LKLKAAVEGFRMDECQNVYSSQDILLEDTQMCAGGKE-GVDSCRGDSGGPLI--GLDTNKVNTYY 354
            ||:      ...|||:..:..:   :.|..:|.|..| |.|:|.|||||||:  |:         
Human   177 LKI------LPNDECKKAHVQK---VTDFMLCVGHLEGGKDTCVGDSGGPLMCDGV--------- 223

  Fly   355 FLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
             |.||.|:|..|||....|.|...|..||.||::||
Human   224 -LQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 77/287 (27%)
Tryp_SPc 128..389 CDD:238113 78/289 (27%)
KLK1NP_002248.1 Tryp_SPc 25..257 CDD:238113 78/289 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.