DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG30414

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:338 Identity:107/338 - (31%)
Similarity:154/338 - (45%) Gaps:78/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GKVLICC--------PDRYRESSSETTPPPKPNVTSNSLLPLPGQCGNILSNRIYGGMKTKIDEF 139
            |..|:.|        |....:||..||.|        ..:|:           |.||....:...
  Fly     7 GLALLVCSIQLGEGAPGHLLDSSCGTTKP--------EFIPM-----------ITGGADAGLFSN 52

  Fly   140 PWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCV----------------NGK----ALPTDW 184
            |||     .|..|:|  .||||||::|:|:||:||:                .||    .:|..:
  Fly    53 PWM-----VKVLGEK--LCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSY 110

  Fly   185 RLSGVRLGEWDTN-TNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQ 248
            :|..:||||:||. ...||         |.|...::.|:|.|.|.||   :.|..|||.|||:..
  Fly   111 KLRRIRLGEYDTRFPGKDC---------CVPKSYELAVDRKILHADY---NLNLDNDIGLLRMKS 163

  Fly   249 QVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDECQNVYSS 313
            .|:|:|:||||||.::.::..:....||    |||.|...:.|....:|.|....:..|::.::.
  Fly   164 FVQYSDYVRPICLLVEGHMAESPIFNIT----GWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTK 224

  Fly   314 QDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTL 378
            |   ::::|:||.|... |:|.|||||||........:...|..|:||:|...|...   .|||.
  Fly   225 Q---VDESQICAAGTNS-DACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSF---SVYTN 282

  Fly   379 VGKYVDWIQNTIE 391
            |..:.|||.|.||
  Fly   283 VTHHRDWIVNAIE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 2/5 (40%)
Tryp_SPc 127..386 CDD:214473 92/279 (33%)
Tryp_SPc 128..389 CDD:238113 94/281 (33%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 92/278 (33%)
Tryp_SPc 41..290 CDD:238113 92/278 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.