DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG12133

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:310 Identity:109/310 - (35%)
Similarity:161/310 - (51%) Gaps:27/310 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VLICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCG-NILSNRIYGGMKTKIDEFPWMALIEYT 148
            |..|||                 :.:...||....|| :..|:.|.|||:.:.::|||..|:.|.
  Fly    35 VFTCCP-----------------MVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYE 82

  Fly   149 KSQGKK--GHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKD 211
            ....|:  ...|.||||::|||:||:||:|    ..|:.::.|||||.||..:||......|.|.
  Fly    83 AYTAKQRPSPMCAGSLIASRYVLTAAHCLN----VNDFYVARVRLGEHDTENDPDYTWLPNGAKI 143

  Fly   212 CAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGIT 276
            .||.|:|:.|:..:||..|...:....||||||||..:|:||..:||||:...:.|.:::|....
  Fly   144 WAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFP 208

  Fly   277 MDVAGWGKTEQLSASNLKLKAAVEGFRMDECQNVYSSQDILLE-DTQMCAGGKEGVDSCRGDSGG 340
            ..:||||.:.....|.:..:..:.|...|||.|.|.:  :|:: |.|:||.|.:|.|:..||||.
  Fly   209 FQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPT--LLVDKDIQICAMGWDGTDTGLGDSGS 271

  Fly   341 PLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390
            ||:.......:.:|:|||:.|:|..|......|.|||....|.:||:..|
  Fly   272 PLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 1/3 (33%)
Tryp_SPc 127..386 CDD:214473 97/261 (37%)
Tryp_SPc 128..389 CDD:238113 99/263 (38%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 99/263 (38%)
Tryp_SPc 62..317 CDD:214473 97/260 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.