DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG8586

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:346 Identity:100/346 - (28%)
Similarity:143/346 - (41%) Gaps:88/346 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DTDRLYLSR------SQCGYTNGKVLICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCGNILS 125
            |::..||.:      ..|||:|.|.||  ||..:...||..                        
  Fly   155 DSESPYLVKQANFKYKNCGYSNPKGLI--PDNDKFPYSEDV------------------------ 193

  Fly   126 NRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVR 190
             .|:|       |||||..| :|   |::...|||:||..|.|:|.||.:..:.:.|    ...|
  Fly   194 -SIFG-------EFPWMVGI-FT---GRQEFLCGGTLIHPRLVVTTSHNLVNETVDT----LVAR 242

  Fly   191 LGEWDTNTNPDCEVDVRGMKDCAP-PHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTD 254
            .|:||.|:..:            | ||....::..|.|.::.|.|  ..||||||.|.:.:....
  Fly   243 AGDWDLNSLNE------------PYPHQGSRIKEIIMHSEFDPNS--LYNDIALLLLDEPIRLAP 293

  Fly   255 FVRPICLP------LDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRM-----DECQ 308
            .::|:|||      |...|.|     :|....|||..|   |.:.||:..::...:     :|||
  Fly   294 HIQPLCLPPPESPELTNQLLS-----VTCYATGWGTKE---AGSDKLEHVLKRINLPLVEREECQ 350

  Fly   309 ----NVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGL 369
                |........|..:.:||||..|.|:|:||.|.||......:::.|. |.|:||:| ..|.:
  Fly   351 AKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQ-LVGIVSWG-VECAV 413

  Fly   370 AGWPGVYTLVGKYVDWIQNTI 390
            ...|.||..|.....||...|
  Fly   414 EDIPAVYVNVPHLRGWIDEKI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 10/27 (37%)
Tryp_SPc 127..386 CDD:214473 83/274 (30%)
Tryp_SPc 128..389 CDD:238113 85/276 (31%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 84/274 (31%)
Tryp_SPc 197..430 CDD:214473 82/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.