DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and Prss21

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006245934.1 Gene:Prss21 / 353251 RGDID:727870 Length:337 Species:Rattus norvegicus


Alignment Length:334 Identity:97/334 - (29%)
Similarity:151/334 - (45%) Gaps:68/334 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VLICCPDRYRESSSETTP--PPKPNVTSNSLLPLPGQCGN-ILSNRIYGGMKTKIDEFPWMALIE 146
            |::......:.:||...|  |.||.:...:|  |.|.||: .:.:||.||.:.::..:||...:.
  Rat    14 VVVAVEVTLQSTSSHVKPVDPEKPELQEANL--LSGPCGHRTIPSRIVGGEEAELGRWPWQGSLR 76

  Fly   147 YTKSQGKKGHH-CGGSLISTRYVITASHCVNGKALPTDWRLSGVRLGE-------WDTNTNPDCE 203
            ..      |:| ||.:|::.|:|:||:||......|.||.   |:.||       |:.....:  
  Rat    77 VW------GNHLCGATLLNRRWVLTAAHCFQKDNDPFDWT---VQFGELTSRPSLWNLQAYSN-- 130

  Fly   204 VDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLR 268
                          ...:|.....|.|   ::...:|||||:|:..|.|::|::||||     |.
  Rat   131 --------------RYQIEDIFLSPKY---TEQFPHDIALLKLSSPVTYSNFIQPICL-----LN 173

  Fly   269 SATFDGITMD--VAGW---GKTEQLSASNLKLKAAVEGFRMDECQNVYSSQD--ILLEDTQMCAG 326
            |........|  |.||   |:.|.|...|...:..|.......|.:::...|  |.:....:|||
  Rat   174 STYKFANRTDCWVTGWGAIGEDESLPLPNNLQEVQVAIINNTMCNHLFKKPDFRINIWGDMVCAG 238

  Fly   327 GKE-GVDSC---------RGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGWPGVYTLVGK 381
            ..| |.|:|         :|||||||:   .|: :|.::..||||:| ..||....|||||.:..
  Rat   239 SPEGGKDACFAKLTYAAPQGDSGGPLV---CNQ-DTVWYQVGVVSWG-IGCGRPNRPGVYTNISH 298

  Fly   382 YVDWIQNTI 390
            :.:||:.|:
  Rat   299 HYNWIRLTM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 1/3 (33%)
Tryp_SPc 127..386 CDD:214473 82/283 (29%)
Tryp_SPc 128..389 CDD:238113 83/285 (29%)
Prss21XP_006245934.1 Tryp_SPc 57..303 CDD:214473 82/283 (29%)
Tryp_SPc 58..304 CDD:238113 82/283 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.