DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ea and CG17572

DIOPT Version :9

Sequence 1:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:343 Identity:108/343 - (31%)
Similarity:158/343 - (46%) Gaps:55/343 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TPLRDTDRLYLSRSQCGYTNGKVLICCPDRYRESSSETTP----PPKPNVTSNSLLPLPGQCG-N 122
            |||.|...|....::..|...|.|.|      ..|||..|    |..| :..|.:      || :
  Fly    76 TPLHDCTALIYEVARSCYYGDKSLYC------GGSSEELPYVCCPSSP-LEKNQV------CGKS 127

  Fly   123 ILSNRIYGGMKTKIDEFPWMALIEYTK-SQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRL 186
            ::....|.|    :..:|::|.|.:.. :.|...:.|.|::|:.|.::||:||...||  ...||
  Fly   128 LVQGHFYKG----LGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKA--DGHRL 186

  Fly   187 SGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVE 251
            |.||:||:||:::|||    .....|||..::..:...|.||||.....:  :|||||.|...:.
  Fly   187 SSVRVGEYDTSSDPDC----ANTGFCAPRSVNHAISHVIVHPDYKQGQYH--HDIALLVLKTPLN 245

  Fly   252 YTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLK------LKAAVEGFRMDECQNV 310
            |:...:||||.   ..|:....|....:|||||   :|.|:::      |...:..:  |.|...
  Fly   246 YSVATQPICLQ---KTRANLVVGKRATIAGWGK---MSTSSVRQPEMSHLDVPLTSW--DLCLRN 302

  Fly   311 YSSQDIL-----LEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLA 370
            |.|...|     :|...||||| ||.|.|:|..|.||.    .:.|..:...|::|||...||..
  Fly   303 YGSTGALESPNSIEGQWMCAGG-EGKDVCQGFGGAPLF----IQENGIFSQIGIMSFGSDNCGGL 362

  Fly   371 GWPGVYTLVGKYVDWIQN 388
            ..|.|||.|..:.:||.:
  Fly   363 RIPSVYTSVAHFSEWIHD 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eaNP_524362.2 CLIP 37..89 CDD:288855 8/25 (32%)
Tryp_SPc 127..386 CDD:214473 88/270 (33%)
Tryp_SPc 128..389 CDD:238113 90/273 (33%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 88/264 (33%)
Tryp_SPc 138..378 CDD:214473 86/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.